McDonnell Genome Institute

Washington University

Transcript

lnc-USP42-1:6

Chromosome

chr7

Gene Name

lnc-USP42-1

Start

6081670

CPC Label

coding

End

6090092

Cancer

CCRC

Strand

+

Peptide

LHMLSHLPR

Modified Peptide

n[272]LHMLSHLPR

Peptide Length

9

ORF Length

35

Open Reading Frame (ORF)

LHMLSHLPRKSLCPQSPEEHMFDTNYKTVNNILNL

Conservation Score

0.111

PhyloCSF Frame 1

-4.198

No. of Spectra

3

CPC Coding Probability

0.898323

PhyloCSF Frame 2 

-4.843

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

-4.149

CNTI Score

-0.334352067