McDonnell Genome Institute

Washington University

Transcript

lnc-USP35-17:1

Chromosome

chr11

Gene Name

lnc-USP35-17

Start

79987512

CPC Label

coding

End

79989630

Cancer

BRCA-Luminal A

Strand

+

Peptide

ISLAAAEDVGK

Modified Peptide

n[145]ISLAAAEDVGK

Peptide Length

11

ORF Length

78

Open Reading Frame (ORF)

LTSERCLKKETQLLLENLHVYHMNYFLVLRCVHKFTSSLPKYPLGRQIRELYRMFRKEHPEFRGVRISLAAAEDVGKG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.988333

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.7442

PhyloCSF Frame 3

0

CNTI Score

0.653732729