McDonnell Genome Institute

Washington University

Transcript

lnc-USP34-1:4

Chromosome

chr2

Gene Name

lnc-USP34-1

Start

61141777

CPC Label

noncoding

End

61144950

Cancer

OV

Strand

-

Peptide

TMAEPNVSSK

Modified Peptide

n[145]TMAEPNVSSK

Peptide Length

10

ORF Length

40

Open Reading Frame (ORF)

LKCQYLLRTMAEPNVSSKLTFFPTISEAASGLSFDFFFFF

Conservation Score

0.996

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.086375

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.82

PhyloCSF Frame 3

0

CNTI Score

-0.350966001