McDonnell Genome Institute

Washington University

Transcript

lnc-USP32-2:8

Chromosome

chr17

Gene Name

lnc-USP32-2

Start

60135761

CPC Label

noncoding

End

60140081

Cancer

OV

Strand

-

Peptide

IDDLPQATPR

Modified Peptide

n[145]IDDLPQATPR

Peptide Length

10

ORF Length

48

Open Reading Frame (ORF)

LDLQGQDKQGTVETILSHSLIFRQNTDLERIDDLPQATPRRRRRATDK

Conservation Score

0.029

PhyloCSF Frame 1

-5.423

No. of Spectra

2

CPC Coding Probability

0.0143903

PhyloCSF Frame 2 

-5.789

CNTI Index

noncoding

Max Probability

0.9275

PhyloCSF Frame 3

-2.772

CNTI Score

-0.362288172