McDonnell Genome Institute

Washington University

Transcript

lnc-USP29-2:1

Chromosome

chr19

Gene Name

lnc-USP29-2

Start

57065333

CPC Label

noncoding

End

57066139

Cancer

PRAD

Strand

+

Peptide

KVAPVPAVMK

Modified Peptide

KVAPVPAVM[147]K

Peptide Length

10

ORF Length

75

Open Reading Frame (ORF)

MQKKKKKNAKEKKVAPVPAVMKKQETMKLVNPLFEKRPKIRILALDRTSNPKRTSRALSNSLTLQWQRTILSVSG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.148582

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3939

PhyloCSF Frame 3

0

CNTI Score

-0.304962338