McDonnell Genome Institute

Washington University

Transcript

lnc-USP25-6:1

Chromosome

chr21

Gene Name

lnc-USP25-6

Start

15434401

CPC Label

noncoding

End

15437227

Cancer

EOGC

Strand

+

Peptide

ELLPVLGGR

Modified Peptide

n[145]ELLPVLGGR

Peptide Length

9

ORF Length

38

Open Reading Frame (ORF)

LVSEGNRGSKAIVFFGRTSLSQIRKLQRELLPVLGGRN

Conservation Score

0.024

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0479821

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9523

PhyloCSF Frame 3

0

CNTI Score

-0.472114172