McDonnell Genome Institute

Washington University

Transcript

lnc-USP24-5:1

Chromosome

chr1

Gene Name

lnc-USP24-5

Start

55372709

CPC Label

noncoding

End

55373316

Cancer

OV

Strand

-

Peptide

SNHSFMPIVLELVPLK

Modified Peptide

n[145]SNHSFMPIVLELVPLK

Peptide Length

16

ORF Length

88

Open Reading Frame (ORF)

LWLLEVDNQVILPIEISIRINCIRRCSIFMSRVSLGLKPDAIPGLLNQATLTSTWPGLYYNQSPEICRSNHSFMPIVLELVPLKCFEN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0358671

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7529

PhyloCSF Frame 3

0

CNTI Score

-0.403731199