McDonnell Genome Institute

Washington University

Transcript

lnc-USP20-6:1

Chromosome

chr9

Gene Name

lnc-USP20-6

Start

129966237

CPC Label

noncoding

End

129968676

Cancer

OSCC

Strand

+

Peptide

DSATALQTGDRVR

Modified Peptide

n[145]DSATALQTGDRVR

Peptide Length

13

ORF Length

75

Open Reading Frame (ORF)

LRQENGLNREAELAESRDSATALQTGDRVRLRLRKKKSLFWGGLTGSLHYTTLEPSFTLAGLQSSADKGAMVMLY

Conservation Score

0.093

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0488758

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5215

PhyloCSF Frame 3

0

CNTI Score

-0.335898996