McDonnell Genome Institute

Washington University

Transcript

lnc-USP17L1-1:1

Chromosome

chr8

Gene Name

lnc-USP17L1-1

Start

7082970

CPC Label

noncoding

End

7083328

Cancer

PRAD

Strand

+

Peptide

VCPLAQLMDSETDMVR

Modified Peptide

VCPLAQLMDSETDMVR

Peptide Length

16

ORF Length

62

Open Reading Frame (ORF)

LDRTDLNRAHFDPEVYLDKLHRVCPLAQLMDSETDMVRQIRAIDSDMQTLVYENYDKFTPAT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0586624

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5587

PhyloCSF Frame 3

0

CNTI Score

-0.279334269