McDonnell Genome Institute

Washington University

Transcript

lnc-USP14-2:1

Chromosome

chr18

Gene Name

lnc-USP14-2

Start

109064

CPC Label

noncoding

End

122217

Cancer

CCRC

Strand

+

Peptide

DVEMEPVQEAEK

Modified Peptide

n[230]DVEMEPVQEAEK

Peptide Length

12

ORF Length

176

Open Reading Frame (ORF)

LCSAYRVHCDISLHRSPSKLFHVRPVTQGDVYRAETEEIPKIFQILYANEGECRKDVEMEPVQEAEKTNFQNHKGHEFIPTLYHFPANCDACAKPLWHVFKPPPALECQRRHVKCHRDHLDKKEDLICPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNPPSGFVRASP

Conservation Score

1

PhyloCSF Frame 1

10.662

No. of Spectra

1

CPC Coding Probability

0.240141

PhyloCSF Frame 2 

9.071

CNTI Index

noncoding

Max Probability

0.9937

PhyloCSF Frame 3

10.673

CNTI Score

-0.433347206