McDonnell Genome Institute

Washington University

Transcript

lnc-UROD-1:2

Chromosome

chr1

Gene Name

lnc-UROD-1

Start

44986790

CPC Label

noncoding

End

44992481

Cancer

EOGC

Strand

+

Peptide

ACEVTTLTHKPWNNSVK

Modified Peptide

n[145]ACEVTTLTHKPWNNSVK

Peptide Length

17

ORF Length

70

Open Reading Frame (ORF)

MACEVTTLTHKPWNNSVKAGTFITKSFLYIAQSTKVFCCLWNLVCKRLEGHAAQGLAVDSDVEHGGVNHG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0783803

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9928

PhyloCSF Frame 3

0

CNTI Score

-0.317714092