McDonnell Genome Institute

Washington University

Transcript

lnc-UQCRHL-5:1

Chromosome

chr1

Gene Name

lnc-UQCRHL-5

Start

15847052

CPC Label

noncoding

End

15847512

Cancer

OV

Strand

-

Peptide

SLAPPAATPGPGLVEDMK

Modified Peptide

n[145]SLAPPAATPGPGLVEDMK

Peptide Length

18

ORF Length

65

Open Reading Frame (ORF)

LRKQERSLAPPAATPGPGLVEDMKRNAIGFHRATGQSGCQGLSPRSQDPFVLRSPGGQLLAFPDT

Conservation Score

0.277

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0629893

PhyloCSF Frame 2 

-2.405

CNTI Index

noncoding

Max Probability

0.95

PhyloCSF Frame 3

-1.266

CNTI Score

-0.342022954