McDonnell Genome Institute

Washington University

Transcript

lnc-UQCC2-1:1

Chromosome

chr6

Gene Name

lnc-UQCC2-1

Start

33679115

CPC Label

coding

End

33684690

Cancer

CCRC

Strand

-

Peptide

GGSAGVLVR

Modified Peptide

n[230]GGSAGVLVR

Peptide Length

9

ORF Length

33

Open Reading Frame (ORF)

LGGKGGSAGVLVRGQFSQPEARLRAATPGDRVN

Conservation Score

1

PhyloCSF Frame 1

1.314

No. of Spectra

20

CPC Coding Probability

0.99969

PhyloCSF Frame 2 

-3.032

CNTI Index

noncoding

Max Probability

0.9963

PhyloCSF Frame 3

-0.872

CNTI Score

-0.286824948