McDonnell Genome Institute

Washington University

Transcript

lnc-UPRT-6:1

Chromosome

chrX

Gene Name

lnc-UPRT-6

Start

75523174

CPC Label

noncoding

End

75523652

Cancer

OSCC

Strand

+

Peptide

LDAGLDLR

Modified Peptide

n[145]LDAGLDLR

Peptide Length

8

ORF Length

84

Open Reading Frame (ORF)

LPPPHPVSRLDAGLDLRKIVKPKKFGSAHLLLLHCVRPLCFCLSLSVSLRSLSLPLLPPPTVTHTHTHTHTHTHTHTQCERCEP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0117349

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9343

PhyloCSF Frame 3

0

CNTI Score

-0.369047429