McDonnell Genome Institute

Washington University

Transcript

lnc-UPK1B-2:1

Chromosome

chr3

Gene Name

lnc-UPK1B-2

Start

119298664

CPC Label

noncoding

End

119299012

Cancer

CRC

Strand

+

Peptide

DISEASVFTAYILPK

Modified Peptide

‚Äč

Peptide Length

15

ORF Length

86

Open Reading Frame (ORF)

LTKKRRGDDCAKKGCSHVQPVRCTICAQCLPKDKAIKKFLIQNTVEATAVRDISEASVFTAYILPKLYVKLHYCVSCAIHSKVVRN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0373223

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7903

PhyloCSF Frame 3

0

CNTI Score

-0.335342756