McDonnell Genome Institute

Washington University

Transcript

lnc-UNCX-3:2

Chromosome

chr7

Gene Name

lnc-UNCX-3

Start

1160245

CPC Label

noncoding

End

1167273

Cancer

PRAD

Strand

+

Peptide

GPQVFLANGSLLR

Modified Peptide

‚Äč

Peptide Length

13

ORF Length

54

Open Reading Frame (ORF)

LRHCTPAWATERDFVSKKKKKKKEEVAASPVTHQLRNKGPQVFLANGSLLRSLF

Conservation Score

0.16

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.423129

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8207

PhyloCSF Frame 3

0

CNTI Score

-0.305099226