McDonnell Genome Institute

Washington University

Transcript

lnc-UNC93B1-1:1

Chromosome

chr11

Gene Name

lnc-UNC93B1-1

Start

68009440

CPC Label

noncoding

End

68017031

Cancer

OV

Strand

-

Peptide

SNAGPVPGGGVGR

Modified Peptide

n[145]SNAGPVPGGGVGR

Peptide Length

13

ORF Length

61

Open Reading Frame (ORF)

MSNAGPVPGGGVGRSCPSLVPDSGSGRAGGCKPRFHHRLPRGPRHLLPDHREEVNAQRAPG

Conservation Score

1

PhyloCSF Frame 1

0.487

No. of Spectra

9

CPC Coding Probability

0.401847

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.914

PhyloCSF Frame 3

0

CNTI Score

-0.29390232