McDonnell Genome Institute

Washington University

Transcript

lnc-UNC93A-1:6

Chromosome

chr6

Gene Name

lnc-UNC93A-1

Start

167228111

CPC Label

noncoding

End

167254245

Cancer

LUAD

Strand

+

Peptide

RVGLLPAWIRR

Modified Peptide

n[230]RVGLLPAWIRR

Peptide Length

11

ORF Length

154

Open Reading Frame (ORF)

LQRQIWATAGVQGGGSCLRHGAGGPCLQPQFGRLPRAQQCLGACRAPACPHPPKSKGRLRSAAATWAAAALSRRVGLLPAWIRRSGQHPQFGRHPGVPQHPGAHGSCLPSALQEHTEARVYRPNSGGCSRAGEIGGAAACSWLPPTPWGTQPQL

Conservation Score

0.988

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.303662

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1028

PhyloCSF Frame 3

0

CNTI Score

-0.261862616