McDonnell Genome Institute

Washington University

Transcript

lnc-UNC13C-4:1

Chromosome

chr15

Gene Name

lnc-UNC13C-4

Start

53428649

CPC Label

noncoding

End

53429884

Cancer

OV

Strand

+

Peptide

KGSNEMR

Modified Peptide

n[145]KGSNEMR

Peptide Length

7

ORF Length

40

Open Reading Frame (ORF)

LVAKEGVEVSYTCGLRWGNTGGGSKGGFWIGKKGSNEMRL

Conservation Score

0

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.067167

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5235

PhyloCSF Frame 3

0

CNTI Score

-0.464996054