McDonnell Genome Institute

Washington University

Transcript

lnc-UMODL1-7:1

Chromosome

chr21

Gene Name

lnc-UMODL1-7

Start

41885094

CPC Label

noncoding

End

41885851

Cancer

BRCA-Luminal B

Strand

+

Peptide

LFVFQPHLLQR

Modified Peptide

n[145]LFVFQPHLLQR

Peptide Length

11

ORF Length

39

Open Reading Frame (ORF)

LFVFQPHLLQRNPPKPVCRLAAGLSSAFKVLLRNTIIVT

Conservation Score

1

PhyloCSF Frame 1

-3.548

No. of Spectra

8

CPC Coding Probability

0.0201678

PhyloCSF Frame 2 

-0.098

CNTI Index

noncoding

Max Probability

0.9948

PhyloCSF Frame 3

-4.074

CNTI Score

-0.420751653