McDonnell Genome Institute

Washington University

Transcript

lnc-UMODL1-4:1

Chromosome

chr21

Gene Name

lnc-UMODL1-4

Start

41767988

CPC Label

noncoding

End

41776144

Cancer

CRC

Strand

+

Peptide

VGHLPVVCISR

Modified Peptide

VGHLPVVCISR

Peptide Length

11

ORF Length

65

Open Reading Frame (ORF)

MRVGHLPVVCISRHSESMEKMSLEVFKPQHKQKAPGPVPLKTEERGVKPAPGATLKKCYSAGWEE

Conservation Score

0.034

PhyloCSF Frame 1

-3.89

No. of Spectra

1

CPC Coding Probability

0.0720998

PhyloCSF Frame 2 

-4.874

CNTI Index

noncoding

Max Probability

0.8775

PhyloCSF Frame 3

-4.911

CNTI Score

-0.337020034