McDonnell Genome Institute

Washington University

Transcript

lnc-UHRF1-2:2

Chromosome

chr19

Gene Name

lnc-UHRF1-2

Start

4970012

CPC Label

noncoding

End

4971369

Cancer

OV

Strand

+

Peptide

SALSGGHDNQAGR

Modified Peptide

n[145]SALSGGHDNQAGR

Peptide Length

13

ORF Length

79

Open Reading Frame (ORF)

LTWGLPGPRSALSGGHDNQAGRGTLSTWARWKVLRGMFSAPGGSGGMDCFWVHPICLLGGGCFCFNNLPAPCEEVFPEL

Conservation Score

0.997

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.0273477

PhyloCSF Frame 2 

-2.438

CNTI Index

noncoding

Max Probability

0.9849

PhyloCSF Frame 3

-3.015

CNTI Score

-0.35312086