McDonnell Genome Institute

Washington University

Transcript

lnc-UGT2B7-1:1

Chromosome

chr4

Gene Name

lnc-UGT2B7-1

Start

69125273

CPC Label

noncoding

End

69126451

Cancer

BRCA-Luminal B

Strand

+

Peptide

AKEHINLCK

Modified Peptide

n[145]AKEHINLCK

Peptide Length

9

ORF Length

53

Open Reading Frame (ORF)

MLKGKKQKQWKAKEHINLCKGRAGIFKNSLEETFCLTKLIVFDQMTSLHYFTR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0443169

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9965

PhyloCSF Frame 3

0

CNTI Score

-0.406420066