McDonnell Genome Institute

Washington University

Transcript

lnc-UGT2A3-5:1

Chromosome

chr4

Gene Name

lnc-UGT2A3-5

Start

68900650

CPC Label

noncoding

End

68900910

Cancer

EOGC

Strand

-

Peptide

LKPLDQK

Modified Peptide

n[145]LKPLDQK

Peptide Length

7

ORF Length

53

Open Reading Frame (ORF)

LKPLDQKLFWIEFVMHHNGAKYLLPPAHKLTWFQYCSLDVLACTALVTLFVIL

Conservation Score

1

PhyloCSF Frame 1

-4.512

No. of Spectra

54

CPC Coding Probability

0.0191939

PhyloCSF Frame 2 

-3.444

CNTI Index

noncoding

Max Probability

0.9973

PhyloCSF Frame 3

-5.671

CNTI Score

-0.362322141