McDonnell Genome Institute

Washington University

Transcript

lnc-UGGT1-8:1

Chromosome

chr2

Gene Name

lnc-UGGT1-8

Start

128027576

CPC Label

noncoding

End

128029675

Cancer

OSCC

Strand

+

Peptide

LSPASTPMSSSIIPPLSHK

Modified Peptide

n[145]LSPASTPM[147]SSSIIPPLSHK

Peptide Length

19

ORF Length

125

Open Reading Frame (ORF)

LLPKSCQHLLNFKPIGPHLDLILFSLLTSSNSSSCLPLASRTRLSPASTPMSSSIIPPLSHKYSILQGSNTLMLYCLPKWFNVFPQFQMSSFLFFVFLRQVLSSAQAEVQWRDHSSLQPRLPCLN

Conservation Score

0.837

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0436022

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6655

PhyloCSF Frame 3

0

CNTI Score

-0.248125168