McDonnell Genome Institute

Washington University

Transcript

lnc-UFL1-2:1

Chromosome

chr6

Gene Name

lnc-UFL1-2

Start

96208168

CPC Label

noncoding

End

96215610

Cancer

CCRC

Strand

+

Peptide

INHILGIILK

Modified Peptide

n[230]INHILGIILK

Peptide Length

10

ORF Length

39

Open Reading Frame (ORF)

LNSLLTDILIACRKINHILGIILKYFRVFCTIQTLITKI

Conservation Score

0.99

PhyloCSF Frame 1

-5.571

No. of Spectra

5

CPC Coding Probability

0.100606

PhyloCSF Frame 2 

-5.06

CNTI Index

noncoding

Max Probability

0.9987

PhyloCSF Frame 3

-5.159

CNTI Score

-0.386873221