McDonnell Genome Institute

Washington University

Transcript

lnc-UCHL5-108:1

Chromosome

chr1

Gene Name

lnc-UCHL5-108

Start

192517636

CPC Label

noncoding

End

192925804

Cancer

PRAD

Strand

-

Peptide

IFFHLCHPR

Modified Peptide

IFFHLCHPR

Peptide Length

9

ORF Length

44

Open Reading Frame (ORF)

LLMLEQHGFELSEYTYMRIFFHLCHPRDSKTNTFSSFSSSAYST

Conservation Score

0.321

PhyloCSF Frame 1

0

No. of Spectra

35

CPC Coding Probability

0.145315

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

-0.381926419