McDonnell Genome Institute

Washington University

Transcript

lnc-UBXN4-14:1

Chromosome

chr2

Gene Name

lnc-UBXN4-14

Start

136239245

CPC Label

noncoding

End

136240669

Cancer

OV

Strand

+

Peptide

TFMISLTQLPGLSFSRLSLYFSQSR

Modified Peptide

n[145]TFM[147]ISLTQLPGLSFSRLSLYFSQSR

Peptide Length

25

ORF Length

52

Open Reading Frame (ORF)

LTFAGRGQSPKTFISMSRTFMISLTQLPGLSFSRLSLYFSQSRGMDLRNCLR

Conservation Score

0.9

PhyloCSF Frame 1

-5.327

No. of Spectra

1

CPC Coding Probability

0.0175894

PhyloCSF Frame 2 

-6

CNTI Index

noncoding

Max Probability

0.9365

PhyloCSF Frame 3

-4.658

CNTI Score

-0.366875712