McDonnell Genome Institute

Washington University

Transcript

lnc-UBXN4-12:1

Chromosome

chr2

Gene Name

lnc-UBXN4-12

Start

136118592

CPC Label

noncoding

End

136119848

Cancer

EOGC

Strand

+

Peptide

ETASAGGVAAAEIAGTEAR

Modified Peptide

n[145]ETASAGGVAAAEIAGTEAR

Peptide Length

19

ORF Length

127

Open Reading Frame (ORF)

LAEVCSGRADSAFPLAPLPSGAETGWGGGASVGRGRETASAGGVAAAEIAGTEARASRHGPQRPPPRNGPEERDCPDCTLHTIPLFYIKRGNISVWSVPEVVRRQGTFSLQSMTFPLCLGPLPNVGG

Conservation Score

1

PhyloCSF Frame 1

-1.823

No. of Spectra

14

CPC Coding Probability

0.0231651

PhyloCSF Frame 2 

-1.172

CNTI Index

noncoding

Max Probability

0.9985

PhyloCSF Frame 3

-2.501

CNTI Score

-0.388758919