McDonnell Genome Institute

Washington University

Transcript

lnc-UBR2-4:1

Chromosome

chr6

Gene Name

lnc-UBR2-4

Start

42759502

CPC Label

noncoding

End

42810401

Cancer

OV

Strand

+

Peptide

DTWPATKGGAASLAR

Modified Peptide

n[145]DTWPATKGGAASLAR

Peptide Length

15

ORF Length

71

Open Reading Frame (ORF)

LVGCCSLWRDTWPATKGGAASLARLARHPALPSLNRIAYSVLRLPELFTDTWGLLGPSFSPSLPRATPSLQ

Conservation Score

0.234

PhyloCSF Frame 1

-3.593

No. of Spectra

1

CPC Coding Probability

0.229901

PhyloCSF Frame 2 

-3.095

CNTI Index

coding

Max Probability

0.0958

PhyloCSF Frame 3

-4.489

CNTI Score

0.718660337