McDonnell Genome Institute

Washington University

Transcript

lnc-UBLCP1-2:11

Chromosome

chr5

Gene Name

lnc-UBLCP1-2

Start

159331527

CPC Label

noncoding

End

159455328

Cancer

OV

Strand

+

Peptide

IHKCDPPGGIK

Modified Peptide

n[145]IHKCDPPGGIK

Peptide Length

11

ORF Length

94

Open Reading Frame (ORF)

LFSSFFSPISCQCLHWLNLAGSQWIKDPVDQRIHKCDPPGGIKKDRNRWKVDLGVAKWKISRMFQIAFLCYMPSQTIALPHHNAHPSLSYLLKD

Conservation Score

0.173

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.113594

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4039

PhyloCSF Frame 3

0

CNTI Score

-0.317172591