McDonnell Genome Institute

Washington University

Transcript

lnc-UBE3C-8:5

Chromosome

chr7

Gene Name

lnc-UBE3C-8

Start

157379815

CPC Label

noncoding

End

157381745

Cancer

OV

Strand

+

Peptide

SPVTNSPSVSLGLNALGLALGK

Modified Peptide

n[145]SPVTNSPSVSLGLNALGLALGK

Peptide Length

22

ORF Length

61

Open Reading Frame (ORF)

LWAEGQVGAWGVRALAVHAFFLFCLLATFSKKSPVTNSPSVSLGLNALGLALGKANWPVSF

Conservation Score

0.052

PhyloCSF Frame 1

-2.861

No. of Spectra

1

CPC Coding Probability

0.0625303

PhyloCSF Frame 2 

-3.405

CNTI Index

noncoding

Max Probability

0.5956

PhyloCSF Frame 3

-4.798

CNTI Score

-0.434189635