McDonnell Genome Institute

Washington University

Transcript

lnc-UBE2V2-7:3

Chromosome

chr8

Gene Name

lnc-UBE2V2-7

Start

48420723

CPC Label

noncoding

End

48474495

Cancer

OSCC

Strand

+

Peptide

TIHPSCITNIAR

Modified Peptide

n[145]TIHPSCITNIAR

Peptide Length

12

ORF Length

95

Open Reading Frame (ORF)

LGCSPLNLLTPGAVPSTRSLRILRREETETIAVFILETKNPRRREPGNGGNDFCPGGLHGIFYVETTFKVFKTIHPSCITNIARYTTDHSPDFNC

Conservation Score

0.03

PhyloCSF Frame 1

-5.075

No. of Spectra

7

CPC Coding Probability

0.0230942

PhyloCSF Frame 2 

-3.061

CNTI Index

noncoding

Max Probability

0.9063

PhyloCSF Frame 3

-4.827

CNTI Score

-0.354790304