McDonnell Genome Institute

Washington University

Transcript

lnc-UBE2S-1:1

Chromosome

chr19

Gene Name

lnc-UBE2S-1

Start

55399744

CPC Label

noncoding

End

55400419

Cancer

OSCC

Strand

-

Peptide

LGYLDQCLINFK

Modified Peptide

n[145]LGYLDQCLINFK

Peptide Length

12

ORF Length

33

Open Reading Frame (ORF)

MRLGYLDQCLINFKKIKNRPGAMAHACNPNFRR

Conservation Score

0.894

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0184283

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9755

PhyloCSF Frame 3

0

CNTI Score

-0.420414445