McDonnell Genome Institute

Washington University

Transcript

lnc-UBE2QL1-4:3

Chromosome

chr5

Gene Name

lnc-UBE2QL1-4

Start

6378698

CPC Label

noncoding

End

6411738

Cancer

OV

Strand

+

Peptide

AATQGCGMMGLVGAGCLVR

Modified Peptide

n[145]AATQGCGMM[147]GLVGAGCLVR

Peptide Length

19

ORF Length

103

Open Reading Frame (ORF)

MTDGNPQEAPNQGSRVLSMKPQEDHDSLLRAATQGCGMMGLVGAGCLVRCRQEPARTQADETRRVSWTLTMVLKGCARTCNRSTTWELVRNANSCPSSRPAES

Conservation Score

0.328

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.229425

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1374

PhyloCSF Frame 3

0

CNTI Score

-0.292037577