McDonnell Genome Institute

Washington University

Transcript

lnc-UBE2QL1-3:1

Chromosome

chr5

Gene Name

lnc-UBE2QL1-3

Start

6134302

CPC Label

noncoding

End

6137171

Cancer

OV

Strand

+

Peptide

AGETVQHTR

Modified Peptide

n[145]AGETVQHTR

Peptide Length

9

ORF Length

117

Open Reading Frame (ORF)

MCNKAGETVQHTRGQPFPLMVAELTPGGGLTPAARARLDFRNMALLAWDSRAVEIPVGGRPGPSHGLGSRKPRFHTMERQPPAWAGRGLSHLLLSSAGLRRAELPGAGVANEDNKQM

Conservation Score

0.068

PhyloCSF Frame 1

-5.154

No. of Spectra

4

CPC Coding Probability

0.184847

PhyloCSF Frame 2 

-5.052

CNTI Index

noncoding

Max Probability

0.8365

PhyloCSF Frame 3

-3.672

CNTI Score

-0.279674531