McDonnell Genome Institute

Washington University

Transcript

lnc-UBE2QL1-2:1

Chromosome

chr5

Gene Name

lnc-UBE2QL1-2

Start

6289856

CPC Label

noncoding

End

6290624

Cancer

OV

Strand

+

Peptide

FTKPDISIGDVAK

Modified Peptide

n[145]FTKPDISIGDVAK

Peptide Length

13

ORF Length

46

Open Reading Frame (ORF)

LFRILPKIKFTKPDISIGDVAKKLAEMWNNLNDSETKPYQSPRQQS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0375977

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

0

CNTI Score

-0.295639719