McDonnell Genome Institute

Washington University

Transcript

lnc-UBE2Q2L-3:2

Chromosome

chr15

Gene Name

lnc-UBE2Q2L-3

Start

84113655

CPC Label

noncoding

End

84121554

Cancer

EOGC

Strand

+

Peptide

CGSEDTAPVIMFVSKMFAVDAK

Modified Peptide

n[145]CGSEDTAPVIM[147]FVSKM[147]FAVDAK

Peptide Length

22

ORF Length

71

Open Reading Frame (ORF)

LKAAFMKCGSEDTAPVIMFVSKMFAVDAKALPQNKPRPLTQEEIAQRRERARQRRDEQQVESMTPKPVLQE

Conservation Score

1

PhyloCSF Frame 1

9.008

No. of Spectra

3

CPC Coding Probability

0.0697605

PhyloCSF Frame 2 

13.323

CNTI Index

noncoding

Max Probability

0.9863

PhyloCSF Frame 3

-5.105

CNTI Score

-0.364319565