McDonnell Genome Institute

Washington University

Transcript

lnc-UBE2Q1-1:1

Chromosome

chr1

Gene Name

lnc-UBE2Q1-1

Start

154561476

CPC Label

noncoding

End

154567777

Cancer

OV

Strand

-

Peptide

MSLNSSLGNR

Modified Peptide

n[145]MSLNSSLGNR

Peptide Length

10

ORF Length

53

Open Reading Frame (ORF)

MSLNSSLGNRARPCLKKKKKKKGWGERLKINVIVLYLRRFRLSVVARTCNPGT

Conservation Score

0.965

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0503249

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3734

PhyloCSF Frame 3

0

CNTI Score

-0.344579155