McDonnell Genome Institute

Washington University

Transcript

lnc-UBE2H-2:8

Chromosome

chr7

Gene Name

lnc-UBE2H-2

Start

129548103

CPC Label

noncoding

End

129611654

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

LLGSRDLPNLASQSAIK

Modified Peptide

n[145]LLGSRDLPNLASQSAIK

Peptide Length

17

ORF Length

126

Open Reading Frame (ORF)

LECNGVISAHCNLRLPGSSDSPTSASQVTGTTGTCHHTQLLSVFIVEMGFRHVGQTDLELLTSGDPPASAPQSAGVTGTSHRAWPFFFFFCIFLVETVFHCVVHVSLKLLGSRDLPNLASQSAIKA

Conservation Score

0.342

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.132322

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.0642

PhyloCSF Frame 3

0

CNTI Score

0.651263767