McDonnell Genome Institute

Washington University

Transcript

lnc-UBE2E2-4:1

Chromosome

chr3

Gene Name

lnc-UBE2E2-4

Start

22989822

CPC Label

noncoding

End

22991582

Cancer

CCRC

Strand

+

Peptide

SLLYAAFMGEPLPPK

Modified Peptide

n[230]SLLYAAFMGEPLPPK

Peptide Length

15

ORF Length

65

Open Reading Frame (ORF)

LARQLDHQHHPQASPLLVQPCWEAQPMGVWEERTASAPQIHEQVHTARSLLYAAFMGEPLPPKAP

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.303482

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.993

PhyloCSF Frame 3

0

CNTI Score

-0.286919771