McDonnell Genome Institute

Washington University

Transcript

lnc-UBASH3A-8:3

Chromosome

chr21

Gene Name

lnc-UBASH3A-8

Start

42461407

CPC Label

noncoding

End

42470557

Cancer

BRCA-Luminal B

Strand

+

Peptide

VEYQGLFK

Modified Peptide

n[145]VEYQGLFK

Peptide Length

8

ORF Length

50

Open Reading Frame (ORF)

LKLRVEYQGLFKTNKQYSNFSSRTQLRKQQQFVVEPQIKQNLASDKGQKM

Conservation Score

0.029

PhyloCSF Frame 1

0

No. of Spectra

26

CPC Coding Probability

0.197413

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

0

CNTI Score

-0.30022382