McDonnell Genome Institute

Washington University

Transcript

lnc-UBASH3A-7:1

Chromosome

chr21

Gene Name

lnc-UBASH3A-7

Start

42274221

CPC Label

noncoding

End

42278087

Cancer

OSCC

Strand

+

Peptide

IQPVSPGLGGEMPGAGGK

Modified Peptide

n[145]IQPVSPGLGGEM[147]PGAGGK

Peptide Length

18

ORF Length

56

Open Reading Frame (ORF)

MEKKSWTTLMLLLPHQLCPSKLRIQPVSPGLGGEMPGAGGKSLMSERRKMTLCCYR

Conservation Score

0.022

PhyloCSF Frame 1

-0.565

No. of Spectra

1

CPC Coding Probability

0.186124

PhyloCSF Frame 2 

-5.101

CNTI Index

noncoding

Max Probability

0.7164

PhyloCSF Frame 3

-4.619

CNTI Score

-0.346643129