McDonnell Genome Institute

Washington University

Transcript

lnc-UBASH3A-1:7

Chromosome

chr21

Gene Name

lnc-UBASH3A-1

Start

42496571

CPC Label

noncoding

End

42498202

Cancer

CRC

Strand

+

Peptide

EVEHASLIPLCSLDTTTNK

Modified Peptide

EVEHASLIPLCSLDTTTNK

Peptide Length

19

ORF Length

44

Open Reading Frame (ORF)

LNGPLLAKRAPETLKTAFSAMMGREVEHASLIPLCSLDTTTNKH

Conservation Score

0.185

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0224596

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7013

PhyloCSF Frame 3

0

CNTI Score

-0.37869499