McDonnell Genome Institute

Washington University

Transcript

lnc-UBAP2-6:5

Chromosome

chr9

Gene Name

lnc-UBAP2-6

Start

33732974

CPC Label

noncoding

End

33738416

Cancer

OV

Strand

-

Peptide

MILNMFFEDIINPPLALFTGMFL

Modified Peptide

n[145]MILNMFFEDIINPPLALFTGMFL

Peptide Length

23

ORF Length

45

Open Reading Frame (ORF)

LFPMFHCHHCQEVLQRRMKKNRMILNMFFEDIINPPLALFTGMFL

Conservation Score

0.176

PhyloCSF Frame 1

-4.629

No. of Spectra

9

CPC Coding Probability

0.0986466

PhyloCSF Frame 2 

-5.232

CNTI Index

noncoding

Max Probability

0.8086

PhyloCSF Frame 3

-5.713

CNTI Score

-0.395755138