McDonnell Genome Institute

Washington University

Transcript

lnc-UBAP1L-1:3

Chromosome

chr15

Gene Name

lnc-UBAP1L-1

Start

65083061

CPC Label

coding

End

65086155

Cancer

CCRC

Strand

-

Peptide

GGGESVK

Modified Peptide

n[230]GGGESVK

Peptide Length

7

ORF Length

35

Open Reading Frame (ORF)

MGGGESVKRNQGKELGSTVNLLPFLGCDSNLKQSN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.529364

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

0

CNTI Score

-0.344535686