McDonnell Genome Institute

Washington University

Transcript

lnc-UBAC2-5:1

Chromosome

chr13

Gene Name

lnc-UBAC2-5

Start

99173592

CPC Label

noncoding

End

99174490

Cancer

BRCA-Basal-like

Strand

+

Peptide

DQGELEKR

Modified Peptide

n[145]DQGELEKR

Peptide Length

8

ORF Length

47

Open Reading Frame (ORF)

LTMAVPMCHCVRGILVRDQGELEKRKFKSVLDCTTDANLSVLNLTIS

Conservation Score

1

PhyloCSF Frame 1

-5.039

No. of Spectra

2

CPC Coding Probability

0.0268123

PhyloCSF Frame 2 

-3.173

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

-4.506

CNTI Score

-0.356857717