McDonnell Genome Institute

Washington University

Transcript

lnc-UAP1L1-5:2

Chromosome

chr9

Gene Name

lnc-UAP1L1-5

Start

137052773

CPC Label

noncoding

End

137053374

Cancer

OV

Strand

+

Peptide

LACSNLLR

Modified Peptide

n[145]LACSNLLR

Peptide Length

8

ORF Length

150

Open Reading Frame (ORF)

LTAAQPEDAGGRAPGEEGPPRLAVGLRASSCPSILDPPGKLGTSLPGPGANSSLREGRTSPSRPRLPQSPEHQQVSACTATWPSCRAAELPASDSPSGWGTWLSTPPPYKPNKGLKGPTRRSLGLLEWRSRLACSNLLRTGQGCSGQALL

Conservation Score

0.065

PhyloCSF Frame 1

-1.673

No. of Spectra

1

CPC Coding Probability

0.120023

PhyloCSF Frame 2 

0.225

CNTI Index

noncoding

Max Probability

0.11

PhyloCSF Frame 3

-2.857

CNTI Score

-0.288805578