McDonnell Genome Institute

Washington University

Transcript

lnc-UAP1L1-4:1

Chromosome

chr9

Gene Name

lnc-UAP1L1-4

Start

137101681

CPC Label

coding

End

137104205

Cancer

PRAD

Strand

+

Peptide

THHLNHFQAWSVVLHSR

Modified Peptide

‚Äč

Peptide Length

17

ORF Length

489

Open Reading Frame (ORF)

LAGCASPGATFCSSQQVLCVCVYVHVCFQVFYCDKTHKTHHLNHFQAWSVVLHSRCCRRAGRWCYTHSHCCRRAGRWCYTHLGCCRRTGQWCYTHAVAGVQVGGVTHIHAVAGVQVGAVTHMLLQEYRSVVLHAVAGVQVGGVTFTLLQACRSVLLHTFLLLQEYRSVVLHVLLQVCRSVVVHTFMLLQEYRSVVLHTFTLLQTCRSVLLHTLLQACRLVVLHSHCCRRAGRWCYTHSFCCRRAGQCYTHSRCCRRAGRWCYTHSRCCRCAGRCCYIHAVASVQVGGVTFTLLLACRSVVLHTFTLLQTCRSVLLHTFMLLQACRSVVLHSHLQACRSVVLHTFMLLQACRSVVLHTFTLLQACRSVVLHSCCCRRAGQWCYTHSRCCRRAGRWYTHSCCCRRAGRWCCTFMLLQACRSVVLHSRCCRSTGQWCYTHSCCCAAITSISRALFILKLKLSHHTVTLHVPPQSLKNTVQVFLPGPHCVEFL

Conservation Score

0.998

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

1

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8668

PhyloCSF Frame 3

0

CNTI Score

-0.303484911