McDonnell Genome Institute

Washington University

Transcript

lnc-TYW1-7:8

Chromosome

chr7

Gene Name

lnc-TYW1-7

Start

67302658

CPC Label

noncoding

End

67309715

Cancer

EOGC

Strand

+

Peptide

LSNVQGR

Modified Peptide

n[145]LSNVQGR

Peptide Length

7

ORF Length

83

Open Reading Frame (ORF)

LARATLSCFGSAMPMYQVKPYHGRGAPLRVELPTCMYRLSNVQGRSGGPAPGVGHLQSLVDEWLDSYKQDQDAGFLELVNFFI

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0389638

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5761

PhyloCSF Frame 3

0

CNTI Score

-0.298817681